PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G149300.1.p
Common NameLOC101754310, SETIT_037583mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 201aa    MW: 20773.7 Da    PI: 8.3704
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G149300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.94e-44311301100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++Cv+apyfp  +p+kfanvhk+FGasnv+kll+++p ++r da+sslvyeA+ar+rdPvyG+vg i++lqqq+e l+
  Seita.9G149300.1.p  31 PCAACKLLRRRCAAGCVFAPYFPPGEPHKFANVHKVFGASNVSKLLQEIPVQHRGDAVSSLVYEANARVRDPVYGCVGAISSLQQQVEALQ 121
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+lal+++e
  Seita.9G149300.1.p 122 AQLALAQAE 130
                         *****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6930131IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4331128IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MRDAVAVAVA VPGVGGRAGG GGGAASSASA PCAACKLLRR RCAAGCVFAP YFPPGEPHKF  60
ANVHKVFGAS NVSKLLQEIP VQHRGDAVSS LVYEANARVR DPVYGCVGAI SSLQQQVEAL  120
QAQLALAQAE MVRLKMSNDY IVHRLKAASR GGGGSSYAGS PSSMSSPKTA EPEAHCKATP  180
ELLDMVVDQP GMDDAQFWSY *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11422GGRAGGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0699110.0BT069911.1 Zea mays full-length cDNA clone ZM_BFb0321D10 mRNA, complete cds.
GenBankKJ7276500.0KJ727650.1 Zea mays clone pUT5577 LOB transcription factor (LOB19) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982247.11e-145PREDICTED: LOB domain-containing protein 4-like
SwissprotQ8LBW33e-58LBD12_ARATH; LOB domain-containing protein 12
TrEMBLK4AFC61e-145K4AFC6_SETIT; Uncharacterized protein
STRINGSi037583m1e-144(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.17e-37LOB domain-containing protein 4